PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00557g01001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 472aa    MW: 53405.7 Da    PI: 5.6815
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00557g01001.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF80.11.5e-251058250
                              ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                    SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                              +ie+ +nrqvt+skRrngilKK +ELSvLCd++va+i+fs++g+l  ys
  Peinf101Scf00557g01001.1 10 KIESLTNRQVTYSKRRNGILKKVYELSVLCDVDVALIMFSPSGRLTHYS 58
                              59********************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.5E-32160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.576161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.07E-25291IPR002100Transcription factor, MADS-box
PRINTSPR004045.8E-22323IPR002100Transcription factor, MADS-box
PfamPF003192.3E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004045.8E-222338IPR002100Transcription factor, MADS-box
PRINTSPR004045.8E-223859IPR002100Transcription factor, MADS-box
PROSITE profilePS512976.671111204IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MGRSKLPLLK IESLTNRQVT YSKRRNGILK KVYELSVLCD VDVALIMFSP SGRLTHYSRK  60
RRIEDVLSEL VSLPDSERGF FISNKESTLW NLRKIEIEDK FCDIERLNPA YLNTSDTTKK  120
IQDEINSLHC KLDEAEGLLR IFEPDTQRIT SLHELDLCEK RLQVALNQVR RRMEQLSSNQ  180
ISSYEGNMEQ INALLQYIDN TQAENTNPSL EKPHYDLWLE LEDYNYPYIP ENNSTSHLYA  240
ASETSSLSQC SMNLPSPTIY DAMSQTSGDT YRKEGSLSSL TDENFKQSQH STRTFPALTR  300
LQTSLTFAKS ELETPTSALR PVAPYLQAEA AAAAASSQQP PPSNNHDKVN TELDSVQPKI  360
TTSKYQMSQT STSGESYLAE GSFTSLTDEN FKQSQCSTRI FPAVTPLQTS FSFAKTELET  420
PTSALRPVAP FMQAEAAVSP SQQLPYTNNE EANHELAWFQ PKMKKSKYHH SA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754443e-44HG975444.1 Solanum pennellii chromosome ch05, complete genome.
GenBankHG9755173e-44HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016454543.10.0PREDICTED: agamous-like MADS-box protein AGL104 isoform X1
TrEMBLK4C1L40.0K4C1L4_SOLLC; Uncharacterized protein
STRINGSolyc05g051830.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA130701416
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.14e-46AGAMOUS-like 104